| NPID | NP05459 |
| Name | Prolactin-2C2 |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Expressed in brain, cerebellum and in Neuro-2a cell line. Expressed in placenta and hair follicles, with highest expression levels detected in the outer root sheath and no expression detected in bulb (at protein level). Isoform 1 and isoform 2 are expressed in brain. Isoform 1 is expressed in Neuro- 2a cells. Expressed in embryonic fibroblasts and at low levels in keratinocytes. |
| Family | Somatotropin/prolactin |
| UniProt ID | PR2C2_MOUSE |
| Length | 195 |
| Modification | |
| Gene Ontology | |
| Sequence | FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFTEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYSALLKSGAMILDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC |
| Properties | View |
| Structure | |
| Reference |
Neuropeptide