NPID | NP05459 |
Name | Prolactin-2C2 |
Organism | Mus musculus |
NCBI Taxa ID | 10090 |
Tissue Specificity | Expressed in brain, cerebellum and in Neuro-2a cell line. Expressed in placenta and hair follicles, with highest expression levels detected in the outer root sheath and no expression detected in bulb (at protein level). Isoform 1 and isoform 2 are expressed in brain. Isoform 1 is expressed in Neuro- 2a cells. Expressed in embryonic fibroblasts and at low levels in keratinocytes. |
Family | Somatotropin/prolactin |
UniProt ID | PR2C2_MOUSE |
Length | 195 |
Modification | |
Gene Ontology | |
Sequence | FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFTEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYSALLKSGAMILDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC |
Properties | View |
Structure | |
Reference |