| NPID | NP05225 |
| Name | QRF-amide |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Expressed in the brain with highest expression levels in the hypothalamus and optic nerve. Also expressed in the trachea and mammary gland. |
| Family | RFamide neuropeptide |
| UniProt ID | OX26_RAT |
| Length | 43 |
| Modification | |
| Gene Ontology | |
| Sequence | QDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRF |
| Properties | View |
| Structure | NA |
| Reference |