NPID | NP05225 |
Name | QRF-amide |
Organism | Rattus norvegicus |
NCBI Taxa ID | 10116 |
Tissue Specificity | Expressed in the brain with highest expression levels in the hypothalamus and optic nerve. Also expressed in the trachea and mammary gland. |
Family | RFamide neuropeptide |
UniProt ID | OX26_RAT |
Length | 43 |
Modification | |
Gene Ontology | |
Sequence | QDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRF |
Properties | View |
Structure | NA |
Reference |