| NPID | NP05223 |
| Name | QRF-amide |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Expressed in the brain with highest levels in the periventricular hypothalamic nucleus and lateral hypothalamic areas. Expressed at moderate levels in the adrenal gland, eye, heart, intestine, liver, lung, kidney, mesenteric lymph node, ovary, placenta, Peyer patches, skin, spleen, stomach, testis, thymus and uterus. |
| Family | RFamide neuropeptide |
| UniProt ID | OX26_MOUSE |
| Length | 43 |
| Modification | |
| Gene Ontology | |
| Sequence | QDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRF |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide