| NPID | NP05222 |
| Name | QRF-amide |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Expressed widely in the brain with highest expression levels in the cerebellum, medulla, pituitary, retina, vestibular nucleus, and white matter. Also expressed in the bladder, colon, coronary artery, parathyroid gland, prostate, testis, and thyroid. |
| Family | RFamide neuropeptide |
| UniProt ID | OX26_HUMAN |
| Length | 43 |
| Modification | |
| Gene Ontology | |
| Sequence | QDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRF |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide