NPID | NP04929 |
Name | ProSAAS |
Organism | Mus musculus |
NCBI Taxa ID | 10090 |
Tissue Specificity | Expressed in brain (mostly hypothalamus and pituitary) and gut. Expressed in trigeminal ganglia and neuroendocrine cell lines. PEN is expressed in pancreas, spinal cord and brain (most abundant in striatum, hippocampus, pons and medulla, and cortex) (at protein level). |
Family | ProSAAS |
UniProt ID | PCSK1_MOUSE |
Length | 225 |
Modification | |
Gene Ontology | |
Sequence | ARPVKEPRSLSAASAPLVETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAAAPRPRPPVYDDGPTGPDVEDAGDETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRSVDQDLGPEVPPENVLGALLRVKRLENPSPQAPARRLLPP |
Properties | View |
Structure | |
Reference |