| NPID | NP04864 |
| Name | Lipotropin gamma |
| Organism | Thunnus obesus |
| NCBI Taxa ID | 8241 |
| Tissue Specificity | |
| Family | POMC |
| UniProt ID | COLI_THUOB |
| Length | 53 |
| Modification | |
| Gene Ontology | |
| Sequence | ELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPAS |
| Properties | View |
| Structure | |
| Reference |