| NPID | NP04818 |
| Name | Corticotropin (By similarity) |
| Organism | Oncorhynchus mykiss |
| NCBI Taxa ID | 8022 |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals. |
| Family | POMC |
| UniProt ID | COLI2_ONCMY |
| Length | 41 |
| Modification | |
| Gene Ontology | |
| Sequence | SYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQA |
| Properties | View |
| Structure | |
| Reference |