NPID | NP04806 |
Name | NPP 1 (By similarity) |
Organism | Oncorhynchus mykiss |
NCBI Taxa ID | 8022 |
Tissue Specificity | C-terminal peptide 1 and C-terminal peptide 2 are detected in the anterior part of the nucleus lateralis tuberis of hypothalamus, in dorsal hypothalamus, thalamus, telencephalon, optic tectum and medulla oblongata (at protein level). Expressed in pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout. |
Family | POMC |
UniProt ID | COLI1_ONCMY |
Length | 80 |
Modification | |
Gene Ontology | |
Sequence | QCWENPRCHDLSSENNLLECIQLCRSDLTTKSPIFPVKVHLQPPSPSDSDSPPLYLPLSLLSPSSPLYPTEQQNSVSPQA |
Properties | View |
Structure | |
Reference |