| NPID | NP04411 |
| Name | Tuberoinfundibular peptide of 39residues |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Expressed in brain, dorsal root ganglion, eye and testis. In brain expressed in cell bodies of three distinct areas: The major one comprises the subparafascicular area posterior through the intralaminar nucleus of the thalamus; a second is the medial paralemniscal nucleus at the pontomesencephalic junction; and a third is in the dorsal and dorsolateral hypothalamic areas, which contained a few, scattered cell bodies. In brain expressed in fibers of limbic areas such as the septum, the amygdala, and the bed nucleus of the stria terminalis; of areas involved in endocrine regulation, such as the hypothalamic dorsomedial, paraventricular, periventricular, and arcuate nuclei; of auditory areas, such as the ectorhinal and temporal cortices, inferior colliculus, medial geniculate body, and some of the nuclei of the superior olivary complex; and in the dorsolateral funiculus of the spinal cord. |
| Family | Parathyroid hormone |
| UniProt ID | TIP39_RAT |
| Length | 39 |
| Modification | |
| Gene Ontology | |
| Sequence | SLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide