| NPID | NP04410 |
| Name | Tuberoinfundibular peptide of 39residues |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Expressed in testis and, less abundantly, in liver and kidney. Expressed in seminiferous tubuli and several brain regions, including nucleus ruber, caudal paralemniscal nucleus, nucleus centralis pontis, and nucleus subparafascicularis thalami. Expressed in neurons of cerebral cortex and subcortical areas. Expressed in Purkinje cells of cerebellum. |
| Family | Parathyroid hormone |
| UniProt ID | TIP39_MOUSE |
| Length | 39 |
| Modification | |
| Gene Ontology | |
| Sequence | SLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP |
| Properties | View |
| Structure | NA |
| Reference |