NPID | NP04409 |
Name | Tuberoinfundibular peptide of 39residues |
Organism | Homo sapiens |
NCBI Taxa ID | 9606 |
Tissue Specificity | Highly expressed in fetal and adult brain, cerebellum and trachea. Weakly expressed in spinal cord, fetal liver, kidney and heart. |
Family | Parathyroid hormone |
UniProt ID | TIP39_HUMAN |
Length | 39 |
Modification | |
Gene Ontology | |
Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
Properties | View |
Structure | NA |
Reference |