| NPID | NP04409 |
| Name | Tuberoinfundibular peptide of 39residues |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Highly expressed in fetal and adult brain, cerebellum and trachea. Weakly expressed in spinal cord, fetal liver, kidney and heart. |
| Family | Parathyroid hormone |
| UniProt ID | TIP39_HUMAN |
| Length | 39 |
| Modification | |
| Gene Ontology | |
| Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Properties | View |
| Structure | NA |
| Reference |