NPID | NP04185 |
Name | Neuropeptide 1 (Probable) |
Organism | Rattus norvegicus |
NCBI Taxa ID | 10116 |
Tissue Specificity | Expressed predominantly in the spinal cord and brain, being more abundant in the hypothalamus and striatum. Also found in small amounts in ovary. |
Family | Opioid |
UniProt ID | PNOC_RAT |
Length | 35 |
Modification | |
Gene Ontology | |
Sequence | MPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQ |
Properties | View |
Structure | NA |
Reference |