| NPID | NP04185 |
| Name | Neuropeptide 1 (Probable) |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Expressed predominantly in the spinal cord and brain, being more abundant in the hypothalamus and striatum. Also found in small amounts in ovary. |
| Family | Opioid |
| UniProt ID | PNOC_RAT |
| Length | 35 |
| Modification | |
| Gene Ontology | |
| Sequence | MPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQ |
| Properties | View |
| Structure | NA |
| Reference |