| NPID | NP04027 |
| Name | Nesfatin-1 |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Found in liver, heart, thymus, muscle, intestine, kidney, lung, spleen and throughout the brain, in cerebral cortex, hippocampus, hypothalamus and medulla oblongata. Nucb2 and necdin levels were higher in postmitotic neurons. |
| Family | Nucleobindin |
| UniProt ID | NUCB2_MOUSE |
| Length | 82 |
| Modification | |
| Gene Ontology | |
| Sequence | VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide