| NPID | NP03747 |
| Name | Neuropeptide W-30 |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Detected at high levels in the substantia nigra, fetal kidney and trachea; at lower levels in testis, uterus, ovary and placenta. Not detectable in many regions of the central nervous system. Also detected at high levels in lymphoblastic leukemia and colorectal adenocarcinoma. |
| Family | Neuropeptide B/W |
| UniProt ID | NPW_HUMAN |
| Length | 30 |
| Modification | |
| Gene Ontology | |
| Sequence | WYKHVASPRYHTVGRAAGLLMGLRRSPYLW |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide