NPID | NP03542 |
Name | NPLP1-5 (Potential) |
Organism | Drosophila melanogaster |
NCBI Taxa ID | 7227 |
Tissue Specificity | MTYamide and NAP peptides are expressed in the larval CNS. IPNamide peptide is expressed in the ventral ganglion of the third larval instar and adult brain (at protein level). |
Family | NA |
UniProt ID | NPLP1_DROME |
Length | 42 |
Modification | |
Gene Ontology | |
Sequence | EDEEMLLPAAAPDYADPMQSYWWYPSYAGYADLDWNDYRRAE |
Properties | View |
Structure | NA |
Reference |