| NPID | NP03542 |
| Name | NPLP1-5 (Potential) |
| Organism | Drosophila melanogaster |
| NCBI Taxa ID | 7227 |
| Tissue Specificity | MTYamide and NAP peptides are expressed in the larval CNS. IPNamide peptide is expressed in the ventral ganglion of the third larval instar and adult brain (at protein level). |
| Family | NA |
| UniProt ID | NPLP1_DROME |
| Length | 42 |
| Modification | |
| Gene Ontology | |
| Sequence | EDEEMLLPAAAPDYADPMQSYWWYPSYAGYADLDWNDYRRAE |
| Properties | View |
| Structure | NA |
| Reference |