NPID | NP03534 |
Name | Amnesiac peptide 56 (Potential) |
Organism | Drosophila melanogaster |
NCBI Taxa ID | 7227 |
Tissue Specificity | Enriched expression in the embryonic and larval nervous systems. Strongly expressed in two large neurons that project over all the lobes of the mushroom bodies. |
Family | NA |
UniProt ID | AMN_DROME |
Length | 56 |
Modification | |
Gene Ontology | |
Sequence | SYIPRPNFSCFSLVFPVGQRFAAARTRFGPTLVASWPLCNDSETKVLTKWPSCSLI |
Properties | View |
Structure | NA |
Reference |