| NPID | NP03534 |
| Name | Amnesiac peptide 56 (Potential) |
| Organism | Drosophila melanogaster |
| NCBI Taxa ID | 7227 |
| Tissue Specificity | Enriched expression in the embryonic and larval nervous systems. Strongly expressed in two large neurons that project over all the lobes of the mushroom bodies. |
| Family | NA |
| UniProt ID | AMN_DROME |
| Length | 56 |
| Modification | |
| Gene Ontology | |
| Sequence | SYIPRPNFSCFSLVFPVGQRFAAARTRFGPTLVASWPLCNDSETKVLTKWPSCSLI |
| Properties | View |
| Structure | NA |
| Reference |