| NPID | NP03430 |
| Name | R15 alpha-1 peptide |
| Organism | Aplysia californica |
| NCBI Taxa ID | 6500 |
| Tissue Specificity | Expressed within the abdominal ganglion in neurons R15, RB(HE), the two L9(G) gill motoneurons, and L40 interneuron, all are parts of autonomic control circuit that contributes to implementing a central command to coordinate autonomic activity with escape locomotion. |
| Family | NA |
| UniProt ID | AGR15_APLCA |
| Length | 38 |
| Modification | |
| Gene Ontology | |
| Sequence | DVSDGSAERRPYTRMGSGGLKLHCQVHPANCPGGLMVT |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide