NPID | NP03430 |
Name | R15 alpha-1 peptide |
Organism | Aplysia californica |
NCBI Taxa ID | 6500 |
Tissue Specificity | Expressed within the abdominal ganglion in neurons R15, RB(HE), the two L9(G) gill motoneurons, and L40 interneuron, all are parts of autonomic control circuit that contributes to implementing a central command to coordinate autonomic activity with escape locomotion. |
Family | NA |
UniProt ID | AGR15_APLCA |
Length | 38 |
Modification | |
Gene Ontology | |
Sequence | DVSDGSAERRPYTRMGSGGLKLHCQVHPANCPGGLMVT |
Properties | View |
Structure | NA |
Reference |