NPID | NP03429 |
Name | Proline-rich mature peptide |
Organism | Aplysia californica |
NCBI Taxa ID | 6500 |
Tissue Specificity | Neurons L2-4 and L6, also called giant dorsal LUQ (Left Upper Quadrant) neurons of the abdominal ganglion. Also expressed in smaller neurons in the CNS and in peripheral organs such as the kidney. |
Family | NA |
UniProt ID | AGN5_APLCA |
Length | 76 |
Modification | |
Gene Ontology | |
Sequence | TIPDRLPQTEESSLPDFGFSHLPALPLELFYNPRDLVHSGFRPRLCSVSGVEGYPPCVESHSDRKMKNLLDDLFGL |
Properties | View |
Structure | NA |
Reference |