| NPID | NP02992 | 
| Name | Motilin-associated peptide | 
| Organism | Cavia porcellus | 
| NCBI Taxa ID | 10141 | 
| Tissue Specificity | Present in the gut mucosa with the exception of the gastric corpus. Also present in medulla oblongata, nucleus of the solitary tract, hypophysis, spinal cord, hypothalamus, and cerebellum but not in the cerebral cortex. | 
| Family | Motilin | 
| UniProt ID | MOTI_CAVPO | 
| Length | 78 | 
| Modification | |
| Gene Ontology | |
| Sequence | SLRVQQRSKAAGRLEPQEVMEEEENGVIKLTAPVEIGVGLSSRQLEKHRAVLEALLSEALPPPSLVFGGQRPVTAAWE | 
| Properties | View | 
| Structure | NA | 
| Reference |