| NPID | NP02928 |
| Name | Pro-MCH 2 |
| Organism | Oncorhynchus tshawytscha |
| NCBI Taxa ID | 74940 |
| Tissue Specificity | Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released. |
| Family | Melanin-concentrating hormone |
| UniProt ID | MCH2_ONCTS |
| Length | 108 |
| Modification | |
| Gene Ontology | |
| Sequence | IPMGKMEDTALEQDTLDSLLNEEVADKNPDSVRSGSSKIIVLADSGMWKNLNRGLPLYKLKAAAAGLDRALTLDRREADQDLSPSISIVRRDTMRCMVGRVYRPCWEV |
| Properties | View |
| Structure | |
| Reference |
Neuropeptide