NPID | NP02850 |
Name | Metastin |
Organism | Mus musculus |
NCBI Taxa ID | 10090 |
Tissue Specificity | Weak in all tissue types with highest levels in lung and 15- 17-day embryos. Expressed in areas of the hypothalamus implicated in the neuroendocrine regulation of gonadotropin secretion, including the anteroventral periventricular nucleus, the periventricular nucleus, and the arcuate nucleus. |
Family | KISS1 |
UniProt ID | KISS1_MOUSE |
Length | 52 |
Modification | |
Gene Ontology | |
Sequence | SSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRY |
Properties | View |
Structure | NA |
Reference |