| NPID | NP02849 |
| Name | Metastasis-suppressor KiSS-1 |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Weak in all tissue types with highest levels in lung and 15- 17-day embryos. Expressed in areas of the hypothalamus implicated in the neuroendocrine regulation of gonadotropin secretion, including the anteroventral periventricular nucleus, the periventricular nucleus, and the arcuate nucleus. |
| Family | KISS1 |
| UniProt ID | KISS1_MOUSE |
| Length | 111 |
| Modification | |
| Gene Ontology | |
| Sequence | EPLAKVAPLVKPGSTGQQSGPQELVNAWEKESRYAESKPGSAGLRARRSSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRYGRRQAARAARG |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide