| NPID | NP02847 |
| Name | Metastin |
| Organism | Macaca mulatta |
| NCBI Taxa ID | 9544 |
| Tissue Specificity | In the hypothalamus, expression increases with puberty in both male and female monkeys. Robust expression in the region of the arcuate nucleus (ARC). |
| Family | KISS1 |
| UniProt ID | KISS1_MACMU |
| Length | 47 |
| Modification | |
| Gene Ontology | |
| Sequence | GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW |
| Properties | View |
| Structure | NA |
| Reference |