NPID | NP02847 |
Name | Metastin |
Organism | Macaca mulatta |
NCBI Taxa ID | 9544 |
Tissue Specificity | In the hypothalamus, expression increases with puberty in both male and female monkeys. Robust expression in the region of the arcuate nucleus (ARC). |
Family | KISS1 |
UniProt ID | KISS1_MACMU |
Length | 47 |
Modification | |
Gene Ontology | |
Sequence | GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW |
Properties | View |
Structure | NA |
Reference |