| NPID | NP02847 | 
| Name | Metastin | 
| Organism | Macaca mulatta | 
| NCBI Taxa ID | 9544 | 
| Tissue Specificity | In the hypothalamus, expression increases with puberty in both male and female monkeys. Robust expression in the region of the arcuate nucleus (ARC). | 
| Family | KISS1 | 
| UniProt ID | KISS1_MACMU | 
| Length | 47 | 
| Modification | |
| Gene Ontology | |
| Sequence | GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW | 
| Properties | View | 
| Structure | NA | 
| Reference | 
