| NPID | NP02844 |
| Name | Metastin |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Very high expression in placenta, with the next highest level in testis and moderate levels in pancreas, liver, small intestine and brain at much lower levels. Expression levels increased in both early placentas and molar pregnancies and are reduced in choriocarcinoma cells. Expressed at higher levels in first trimester trophoblasts than at term of gestation, but only expressed in the villous trophoblast. |
| Family | KISS1 |
| UniProt ID | KISS1_HUMAN |
| Length | 54 |
| Modification | |
| Gene Ontology | |
| Sequence | GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF |
| Properties | View |
| Structure | NA |
| Reference |