| NPID | NP02189 |
| Name | Cholecystokinin-58 desnonopeptide (By similarity) |
| Organism | Macaca fascicularis |
| NCBI Taxa ID | 9541 |
| Tissue Specificity | |
| Family | Gastrin/cholecystokinin |
| UniProt ID | CCKN_MACFA |
| Length | 49 |
| Modification | |
| Gene Ontology | |
| Sequence | AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISD |
| Properties | View |
| Structure | |
| Reference |