| NPID | NP02184 |
| Name | Cholecystokinin-33 |
| Organism | Lithobates catesbeiana |
| NCBI Taxa ID | 8400 |
| Tissue Specificity | Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem. |
| Family | Gastrin/cholecystokinin |
| UniProt ID | CCKN_LITCT |
| Length | 33 |
| Modification | |
| Gene Ontology | |
| Sequence | GSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF |
| Properties | View |
| Structure | |
| Reference |