| NPID | NP01016 |
| Name | CCB peptide long form |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Expressed in the brain, adrenal medulla and anterior pituitary. In the brain, localized to the hippocampal formation, the endocrine hypothalamus, the olfactory system, and in anatomically distinct structures in the pons-medulla. |
| Family | Chromogranin/secretogranin |
| UniProt ID | SCG1_RAT |
| Length | 61 |
| Modification | |
| Gene Ontology | |
| Sequence | AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQRG |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide