| NPID | NP00948 |
| Name | Pancreastatin (By similarity) |
| Organism | Equus caballus |
| NCBI Taxa ID | 9796 |
| Tissue Specificity | Highly expressed in adrenal medulla and pituitary gland. Weaker expression detected in cerebrum, cerebellum, spinal cord, liver, thyroid gland, striated muscle, lung, spleen, kidney, parotid gland, and sublingual gland. |
| Family | Chromogranin/secretogranin |
| UniProt ID | CMGA_HORSE |
| Length | 49 |
| Modification | |
| Gene Ontology | |
| Sequence | SEALVVDGARKTGAEEAQPPEGQGEREHSRQEEEEEEETAGASRGLFRG |
| Properties | View |
| Structure | |
| Reference |