NPID | NP00922 |
Name | Cerebellin-1 |
Organism | Rattus norvegicus |
NCBI Taxa ID | 10116 |
Tissue Specificity | Localized in the Purkinje cells. Cerebellin is expressed in adrenal gland /adrenal cortex (at protein level). In the cerebellum, [des-Ser1]-cerebellin is more abundant than cerebellin. At lower levels also found in heart, kidney stomach and gastrointestinal tract. |
Family | Cerebellins |
UniProt ID | CBLN1_RAT |
Length | 172 |
Modification | |
Gene Ontology | |
Sequence | QNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL |
Properties | View |
Structure | NA |
Reference |