| NPID | NP00922 |
| Name | Cerebellin-1 |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Localized in the Purkinje cells. Cerebellin is expressed in adrenal gland /adrenal cortex (at protein level). In the cerebellum, [des-Ser1]-cerebellin is more abundant than cerebellin. At lower levels also found in heart, kidney stomach and gastrointestinal tract. |
| Family | Cerebellins |
| UniProt ID | CBLN1_RAT |
| Length | 172 |
| Modification | |
| Gene Ontology | |
| Sequence | QNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide