| NPID | NP00919 |
| Name | Cerebellin-4 |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Expressed in brain with high levels in particular thalamic nuclei. In the thalamus, predominantly expressed in neurons within the parafascicular nucleus (at protein level). Very low or no expression in most other brain regions. |
| Family | Cerebellins |
| UniProt ID | CBLN4_MOUSE |
| Length | 174 |
| Modification | |
| Gene Ontology | |
| Sequence | QNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLLGGWQYSTFSGFLVFPL |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide