| NPID | NP00918 |
| Name | Cerebellin-3 |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Expressed in brain, restricted to the cerebellar cortex. Within the cerebellum, expressed in granule layers (at protein level). Also detected in postsynaptic Purkinje cell spines (at protein level). |
| Family | Cerebellins |
| UniProt ID | CBLN3_MOUSE |
| Length | 173 |
| Modification | |
| Gene Ontology | |
| Sequence | QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL |
| Properties | View |
| Structure | NA |
| Reference |