NPID | NP00918 |
Name | Cerebellin-3 |
Organism | Mus musculus |
NCBI Taxa ID | 10090 |
Tissue Specificity | Expressed in brain, restricted to the cerebellar cortex. Within the cerebellum, expressed in granule layers (at protein level). Also detected in postsynaptic Purkinje cell spines (at protein level). |
Family | Cerebellins |
UniProt ID | CBLN3_MOUSE |
Length | 173 |
Modification | |
Gene Ontology | |
Sequence | QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL |
Properties | View |
Structure | NA |
Reference |