| NPID | NP00881 |
| Name | Cocaine- and amphetamine-regulated |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. |
| Family | CART |
| UniProt ID | CART_HUMAN |
| Length | 89 |
| Modification | |
| Gene Ontology | |
| Sequence | QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
| Properties | View |
| Structure | |
| Reference |