| NPID | NP00876 |
| Name | CART(62-102) (Potential) |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Neuroendocrine tissues. Predominantly expressed in the hypothalamus, pituitary, and longitudinal muscle- myenteric plexus. Abundant expression is also seen in the midbrain/thalamus and eye. A lower level expression is seen in the other brain regions and adrenal. |
| Family | CART |
| UniProt ID | CART_RAT |
| Length | 41 |
| Modification | |
| Gene Ontology | |
| Sequence | YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide