| NPID | NP00875 |
| Name | CART(55-102) |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Neuroendocrine tissues. Predominantly expressed in the hypothalamus, pituitary, and longitudinal muscle- myenteric plexus. Abundant expression is also seen in the midbrain/thalamus and eye. A lower level expression is seen in the other brain regions and adrenal. |
| Family | CART |
| UniProt ID | CART_RAT |
| Length | 48 |
| Modification | |
| Gene Ontology | |
| Sequence | IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide