| NPID | NP00842 |
| Name | Calcitonin receptor-stimulating peptide 2 |
| Organism | Sus scrofa |
| NCBI Taxa ID | 9823 |
| Tissue Specificity | Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of the cerebrum, hippocampus, hypothalamus, pons/midbrain and thalamus. Also detected in the glia-like cells of pons/midbrain and in meninx of tactus opticus. |
| Family | Calcitonin |
| UniProt ID | CRSP2_PIG |
| Length | 38 |
| Modification | |
| Gene Ontology | |
| Sequence | SCNTASCVTHKMTGWLSRSGSVAKNNFMPTNVDSKILG |
| Properties | View |
| Structure | |
| Reference |
Neuropeptide