| NPID | NP00841 | 
| Name | Calcitonin receptor-stimulating peptide 1 | 
| Organism | Sus scrofa | 
| NCBI Taxa ID | 9823 | 
| Tissue Specificity | Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of cerebrum, hippocampus, hypothalamus, pons/midbrain and thalamus. | 
| Family | Calcitonin | 
| UniProt ID | CRSP1_PIG | 
| Length | 38 | 
| Modification | |
| Gene Ontology | |
| Sequence | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG | 
| Properties | View | 
| Structure | |
| Reference | 
