| NPID | NP00841 |
| Name | Calcitonin receptor-stimulating peptide 1 |
| Organism | Sus scrofa |
| NCBI Taxa ID | 9823 |
| Tissue Specificity | Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of cerebrum, hippocampus, hypothalamus, pons/midbrain and thalamus. |
| Family | Calcitonin |
| UniProt ID | CRSP1_PIG |
| Length | 38 |
| Modification | |
| Gene Ontology | |
| Sequence | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG |
| Properties | View |
| Structure | |
| Reference |