NPID | NP00841 |
Name | Calcitonin receptor-stimulating peptide 1 |
Organism | Sus scrofa |
NCBI Taxa ID | 9823 |
Tissue Specificity | Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of cerebrum, hippocampus, hypothalamus, pons/midbrain and thalamus. |
Family | Calcitonin |
UniProt ID | CRSP1_PIG |
Length | 38 |
Modification | |
Gene Ontology | |
Sequence | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG |
Properties | View |
Structure | |
Reference |