| NPID | NP00727 | 
| Name | CHH precursor-related peptide(Potential) | 
| Organism | Procambarus clarkii | 
| NCBI Taxa ID | 6728 | 
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. | 
| Family | Arthropod CHH/MIH/GIH/VIH hormone | 
| UniProt ID | CHH_PROCL | 
| Length | 33 | 
| Modification | |
| Gene Ontology | |
| Sequence | RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN | 
| Properties | View | 
| Structure | NA | 
| Reference | 
