NPID | NP00716 |
Name | Molt-inhibiting hormone |
Organism | Penaeus japonicus |
NCBI Taxa ID | 27405 |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released. |
Family | Arthropod CHH/MIH/GIH/VIH hormone |
UniProt ID | MIH_PENJP |
Length | 77 |
Modification | |
Gene Ontology | |
Sequence | SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ |
Properties | View |
Structure | NA |
Reference |