NPID | NP00713 |
Name | Crustacean hyperglycemic hormone 5 |
Organism | Penaeus japonicus |
NCBI Taxa ID | 27405 |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. |
Family | Arthropod CHH/MIH/GIH/VIH hormone |
UniProt ID | CHH5_PENJP |
Length | 72 |
Modification | |
Gene Ontology | |
Sequence | LVFDPSCAGVYDRVLLGKLNRLCDDCYNVFREPNVATECRSNCFYNLAFVQCLEYLMPPSLHEEYQANVQMV |
Properties | View |
Structure | NA |
Reference |