| NPID | NP00711 |
| Name | Crustacean hyperglycemic hormone 3 |
| Organism | Penaeus japonicus |
| NCBI Taxa ID | 27405 |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. |
| Family | Arthropod CHH/MIH/GIH/VIH hormone |
| UniProt ID | CHH3_PENJP |
| Length | 72 |
| Modification | |
| Gene Ontology | |
| Sequence | SLFDPACTGIYDRQLLRKLGRLCDDCYNVFREPKVATGCRSNCYHNLIFLDCLEYLIPSHLQEEHMAAMQTV |
| Properties | View |
| Structure | NA |
| Reference |