| NPID | NP00701 |
| Name | Crustacean hyperglycemic hormone B |
| Organism | Metapenaeus ensis |
| NCBI Taxa ID | 32278 |
| Tissue Specificity | Expressed at a constant level in the eyestalks of juveniles and mature females. A low level expression is seen in the central nervous system. |
| Family | Arthropod CHH/MIH/GIH/VIH hormone |
| UniProt ID | CHHB_METEN |
| Length | 72 |
| Modification | |
| Gene Ontology | |
| Sequence | SLFDPSCTGVFDRELLGRLNRVCDDCYNVFREPKVATECRSHCFLNPAFIQCLEYIIPEVLHEEYQANVQLV |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide