NPID | NP00698 |
Name | Crustacean hyperglycemic hormone |
Organism | Macrobrachium lanchesteri |
NCBI Taxa ID | 82204 |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. |
Family | Arthropod CHH/MIH/GIH/VIH hormone |
UniProt ID | CHH_MACLE |
Length | 72 |
Modification | |
Gene Ontology | |
Sequence | AILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCREGCYQNLVFRQCIQDLQLMDQLDEYANAVQIV |
Properties | View |
Structure | NA |
Reference |