| NPID | NP00690 |
| Name | CHH precursor-related peptide B |
| Organism | Homarus americanus |
| NCBI Taxa ID | 6706 |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system. |
| Family | Arthropod CHH/MIH/GIH/VIH hormone |
| UniProt ID | CHHB_HOMAM |
| Length | 34 |
| Modification | |
| Gene Ontology | |
| Sequence | RSVEGVSRMEKLLSSSISPSSTPLGFLSQDHSVN |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide