| NPID | NP00603 |
| Name | Apelin-31 (By similarity) |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain. Secreted by the mammary gland into the colostrum and the milk. |
| Family | Apelin |
| UniProt ID | APEL_HUMAN |
| Length | 31 |
| Modification | |
| Gene Ontology | |
| Sequence | GSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Properties | View |
| Structure | NA |
| Reference |