| NPID | NP00599 |
| Name | Apelin-31 |
| Organism | Bos taurus |
| NCBI Taxa ID | 9913 |
| Tissue Specificity | Large amount secreted by the mammary gland in the colostrum. Lower levels in milk. Decreases rapidly within several days after parturition in milk, but is still detectable even in commercial milk. |
| Family | Apelin |
| UniProt ID | APEL_BOVIN |
| Length | 31 |
| Modification | |
| Gene Ontology | |
| Sequence | GPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Properties | View |
| Structure | NA |
| Reference |