| NPID | NP00047 |
| Name | Intermedin-short (Potential) |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | High expression detected in the submaxillary gland, kidney, stomach, and mesentery, followed by the pituitary, lung, pancreas, intestines, spleen, thymus and ovary. Expressed mainly in the intermediate lobe of the pituitary, with sporadic in the anterior lobe. |
| Family | Adrenomedullin |
| UniProt ID | ADM2_MOUSE |
| Length | 40 |
| Modification | |
| Gene Ontology | |
| Sequence | VGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY |
| Properties | View |
| Structure | NA |
| Reference |