| NPID | NP00043 |
| Name | Intermedin-short (Potential) |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. Expressed in myocardial cells of the heart, renal tubular cells, hypothalamus, and pituitary. |
| Family | Adrenomedullin |
| UniProt ID | ADM2_HUMAN |
| Length | 40 |
| Modification | |
| Gene Ontology | |
| Sequence | VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide