| NPID | NP00034 |
| Name | Acyl-CoA-binding protein |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. |
| Family | ACBP |
| UniProt ID | ACBP_HUMAN |
| Length | 86 |
| Modification | |
| Gene Ontology | |
| Sequence | SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI |
| Properties | View |
| Structure | |
| Reference |
Neuropeptide