Total number of results for Trachemys scripta are 10
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00808 | RPPGFTPFR |
9 | Trachemys scripta | Bradykinin | [Thr6]-bradykinin | 2298179#Conlon JM, Hicks JW, Smith DD#Isolation and biological activity of a novel kinin ([Thr6] bradykinin) from the turtle, Pseudemys scripta#Endocrinology 1990 Feb;126(2):985-91 | |
| NP02220 | QQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS |
110 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02221 | RLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF |
58 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-58 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02222 | YLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF |
40 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-40 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02223 | GPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF |
33 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-33 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02224 | DYMGWMDF |
8 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-8 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02225 | YMGWMDF |
7 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-7 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02438 | HSQGTFTSDYSKYLDTRRAQDFVQWLMST |
29 | Trachemys scripta | Glucagon | Glucagon | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). | |
| NP02748 | AANQHLCGSHLVEALYLVCGERGFFYSPKA |
30 | Trachemys scripta | Insulin | Insulin B chain | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). | |
| NP02749 | GIVEQCCHNTCSLYQLENYCN |
21 | Trachemys scripta | Insulin | Insulin A chain | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). |