Total number of results for Trachemys dorbigni are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02746 | AANQHLCGSHLVEALYLVCGERGFFYSPKA |
30 | Trachemys dorbigni | Insulin | Insulin B chain | 1808015#Cascone O., Turyn D., Dellacha J.M., Machado V.L.A., Marques M., Vita N., Cassan C., Ferrara P., Guillemot J.-C.#Isolation, purification and primary structure of insulin from the turtle Chrysemys dorbigni.# Gen. Comp. Endocrinol. 84:355-359(1991). | |
| NP02747 | GIVEQCCHNTCSLYQLENYCN |
21 | Trachemys dorbigni | Insulin | Insulin A chain | 1808015#Cascone O., Turyn D., Dellacha J.M., Machado V.L.A., Marques M., Vita N., Cassan C., Ferrara P., Guillemot J.-C.#Isolation, purification and primary structure of insulin from the turtle Chrysemys dorbigni.# Gen. Comp. Endocrinol. 84:355-359(1991). |